SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000338093 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000338093
Domain Number 1 Region: 122-347
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.08e-72
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.000000587
Further Details:      
 
Domain Number 2 Region: 349-457
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 9.36e-28
Family Anticodon-binding domain of Class II aaRS 0.0012
Further Details:      
 
Domain Number 3 Region: 44-137
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 8.63e-24
Family Threonyl-tRNA synthetase (ThrRS), second 'additional' domain 0.003
Further Details:      
 
Domain Number 4 Region: 9-41
Classification Level Classification E-value
Superfamily TGS-like 0.00000305
Family TGS domain 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000338093
Sequence length 466
Comment TARSL2 (Homo_sapiens) threonyl-tRNA synthetase-like 2
Sequence
MPSGVSQRSQELAENTVIAKVNGELWDLDRPLEGDSTLELLMFDNEEAQAVYWHSSAHIL
GEAMELYYGGHLCYGPPIENGFYYDMFIEDRAVSSTELAALENICKSIIKEKQPFERLEV
SKETLLDMFKEEYHNHNFTEVLSPNMYNSKLWETSGHWQHYSENMFTFDIEKDTFALKPM
NCPGHCLMFAHRPRSWREMPIRFADFGVLHRNELSGTLSGLTRVRRFQQDDAHIFCTVEQ
IEEEIKGCLQFLQSVYSTFGFSFQLNLSTRPEKFLGEMEMWDEAEKIDIKIKDAIGRYHQ
CATIQLDFQLPIRFNLTYVSKDGDDKKRPMIIHRAILGSVERMIAILSENYGGKWPFWLS
PRQIMVIPVGPTCEEYALQVSNEFFEEGFMADVDLDDSCTLNKKIRNAQLAQYNFILVVG
EKEKINNAVNVRTRDNKIHGEISVTSAIDKLKNLKKSRTLNAEERF
Download sequence
Identical sequences G5ARZ6
HGL_H00000338093

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]