SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000338360 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000338360
Domain Number 1 Region: 278-343
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 3.66e-16
Family HLH, helix-loop-helix DNA-binding domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000338360
Sequence length 454
Comment TFE3 (Homo_sapiens) transcription factor binding to IGHM enhancer 3
Sequence
MPLSATVSITSTLCNSLNSLLPESGIVADIELENILDPDSFYELKSQPLPLRSSLPISLQ
ATPATPATLSASSSAGGSRTPAMSSSSSSRVLLRQQLMWSQAQEQRRERREQAAATPFPS
PAPASPAISVVGVSAGGHTLSRPPPAQVPREVLKVQTHLENPTRYHLQQARRQQVKQYLS
TTLGPKLASQALTPPPIDDVIDEIISLESSYNDEMLSYLPGGTAGLQLPSTLPVSGNLLD
VYSSQGVATPAITVSNSCPAELPNIKQEISETEAKALLKERQKKDNHNLIERRRRFNIND
RIKELGTLIPKSNDPEMRWNKGTILKASVDYIRKLQKEQQRSKDLESRQRSLEQANRSLQ
LRIQNVPHQQPPAPPSDALLDLHFPSDHLGDLGDPFHLGLEDILMEEEEGMVGGLSGDAL
SPLRAASDPLLSSVSPAVSKASSRRSSFSMEEES
Download sequence
Identical sequences G5BJJ2
HGL_H00000338360

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]