SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000340635-1 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000340635-1
Domain Number 1 Region: 1-83
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 1.22e-17
Family Cofilin-like 0.0000682
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000340635-1
Sequence length 83
Comment CFL2 (Homo_sapiens) cofilin 2 (muscle)
Sequence
MALGVTVNDEVIEVFNEMKIWQSSTQEIKKRKKAVLFHLSNDRRQIIVEEVKQILVGGIG
DTVEDLYTSFVKLLPLNECRYAL
Download sequence
Identical sequences G5AWX5
HGL_H00000340635-1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]