SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000341268 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000341268
Domain Number 1 Region: 9-164
Classification Level Classification E-value
Superfamily TRADD, N-terminal domain 5.62e-61
Family TRADD, N-terminal domain 0.000000386
Further Details:      
 
Domain Number 2 Region: 219-303
Classification Level Classification E-value
Superfamily DEATH domain 0.0000000000000235
Family DEATH domain, DD 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000341268
Sequence length 310
Comment TRADD (Homo_sapiens) TNFRSF1A-associated via death domain
Sequence
MATGSNGDEEWVGSAYLFLESSVDKVVLSDAYAHPQKKVAVYGALRTALAESSESPDALQ
ILKIHSSDSQLIVQLRFCGRQSCGCFLRAYREGALRATLQRYLAAALDQPSLPLQLELLA
GAERLDSWLTNEERCVHSILAQKPDRLRDEELAELEDALSNLTLGSAGQGSDSGVTPAPS
QSLGPSPLEEKLPPQAGQTFLFQGHPIVNRPLNLQDQQTFARSVGLKWRRVGRSLQRSCR
ALRDPALDSLAYEYEREGLYEQAFQLLRRFVQAEGRRATLQRLVEALEENELTSLAEDLL
GLADPNSGLA
Download sequence
Identical sequences G5C644
HGL_H00000341268

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]