SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000341885-1 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000341885-1
Domain Number 1 Region: 116-194
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.53e-25
Family Translational machinery components 0.0041
Further Details:      
 
Domain Number 2 Region: 42-95
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 0.00000000000000209
Family Ribosomal S5 protein, N-terminal domain 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000341885-1
Sequence length 229
Comment RPS2 (Homo_sapiens) ribosomal protein S2
Sequence
MADDSGAAGGPGGPGGPGVEGRGGFRGGFGSGVRAESEIIDFFLGTSLKDEVLKIMPVQK
QTRAGQRTRFKAFVTIGDYNGHVGLGVKCSKEVAIILAKLSRRGYWGNKIGKAHIVPCKV
TGRCGSVLVRLIPAPRGTGIISAPVPKKLLLMAGIDDCYTSARGCTATLGNFAKATFDAI
SKTYSYLTPDLWKETVFTKSPYQEFSDHLVKTHTRVSVQRTQAPAVATT
Download sequence
Identical sequences G5AKT6
HGL_H00000341885-1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]