SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000341885-6 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000341885-6
Domain Number 1 Region: 75-130
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 0.00000000000733
Family Translational machinery components 0.014
Further Details:      
 
Domain Number 2 Region: 26-90
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 0.00000000022
Family Ribosomal S5 protein, N-terminal domain 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000341885-6
Sequence length 170
Comment RPS2 (Homo_sapiens) ribosomal protein S2
Sequence
MKIKSLEEIYLFSLPIKESEIIDFFPGTSLMDEVLKIMPVQEQTRAGQWTRFKPFVTIRD
YKGLIGLGVKHSKEACGSVLVCLTPAPKKLLLMAGINDCYTPARGCTATLDNFAKATFDA
ISKTYSYLTPWTSGKRLFTKFPCQEVTDHLVKTHTRISVQRTQAPAAATI
Download sequence
Identical sequences G5BZ05
HGL_H00000341885-6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]