SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000342278 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000342278
Domain Number 1 Region: 524-670
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 1.15e-62
Family 2'-5'-oligoadenylate synthetase 1, OAS1, second domain 0.00000493
Further Details:      
 
Domain Number 2 Region: 333-521
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 1.59e-59
Family 2'-5'-oligoadenylate synthetase 1, OAS1, N-terminal domain 0.00000651
Further Details:      
 
Domain Number 3 Region: 192-320
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 7.59e-44
Family 2'-5'-oligoadenylate synthetase 1, OAS1, second domain 0.0000508
Further Details:      
 
Domain Number 4 Region: 8-191
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 3.6e-40
Family 2'-5'-oligoadenylate synthetase 1, OAS1, N-terminal domain 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000342278
Sequence length 675
Comment OAS2 (Homo_sapiens) 2'-5'-oligoadenylate synthetase 2, 69/71kDa
Sequence
MGNWESHVSSVPAPELGRFIQQQLRPYEGCEKQLQMTVDTIRLFLPGDSFPQVQGVAMGG
SYGRKTVLRGDSDGTLIVFLDHLEHFRDQVKIQDKILNAITHQLEECRRVRTLPVQWETL
RTPKGLSIVLSTRWQKITFEVLPAFNALGLCENPSPWLYRELIRFMDETKASPGDFAVCF
TQLQQKFFNKYPKKVKDLIILIKYWYQQCQKKSGSNVPLATYALELLAVYAWEQGCGAED
FDIAEGVRAILGLILKSQQLCVYWTVNYSLEDETVRNRLLGQLRTQRPVILDPVDLTHSV
SGHIPWLELQADAQGWLSSLSSTPAWSVLPAPLFMTPAHRLDWFIKDFLQPNENFLKQTL
KAVDIICKFLRENCFRHSTTKVQSIIKGGSAAKGTALKTGSDADIIVFLNSLESFPSQKT
YRSKIIQEIRQQMEACQQQQAFEVKFEVSKWTAPRVLSFSLKSRELNESVDFDVLPAYNV
LGQRKSTLRAYAELIHLYQSSDTVGGEFSTCFTELQRDFILSRPTKLKDLIRLVKHWYKQ
CEKKMKSKGSLPPKYALELLTVYAWERGSGADDFSTAKGFRTVLELITKYQQLCIYWTVN
YNFDDETIRSFVLTQIQRPRPVILDPAEPTGDVGGGDRWCWHLLAKEAKEWFSSLCFRDG
QGNSIQPWKVPVSVL
Download sequence
Identical sequences G5AKW0
HGL_H00000342278

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]