SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000342557-1 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000342557-1
Domain Number 1 Region: 67-309
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.07e-34
Family FAD-linked reductases, N-terminal domain 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000342557-1
Sequence length 336
Comment IL4I1 (Homo_sapiens) interleukin 4 induced 1
Sequence
MGTERAPQGQPCTLHLLALAPILFSLAPSLAWKEASSQDPFEKCMHDPDYELLLKVVTQG
LNRTLQPQKVIVVGAGVAGLVAAKVLSDGGHKVTVLEADNRIGGRILTFRDPKTSWSGEL
GAMRMPSSHRILHMLCKSLGLNLTKFTQYDENTWTEVNGVKLRNYVVEKMPEKLGYKLRP
KERGRSPEDIYQMALNKAQKDVKALGCRKALRKFERHTLLEFLRGEGNLSRPAVQLLGDV
MSKDGFFYLSFEEALRAHSCLSDQLRYSRIVGGWDLLPRALLSSLSGPVLLNAPVVAVTQ
GTRDVRVHIDLEXXXXXXXXXXXXXXXXXXXXXXXX
Download sequence
Identical sequences HGL_H00000342557-1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]