SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000342557-2 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000342557-2
Domain Number 1 Region: 108-424
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.68e-35
Family FAD-linked reductases, N-terminal domain 0.0000302
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000342557-2
Sequence length 455
Comment IL4I1 (Homo_sapiens) interleukin 4 induced 1
Sequence
MKAGSTQVRRELTQLTPHPQLQAPDFHPDVKSSAPRTASQRGGYWGVWLDRVLRGPQKET
QGWLALALLSVLDAQTQAFNPRLVECFEDPQYEELLQLARDGLGHTANKKEVVIIGAGMA
GLTAAKTLQDAGHQVTVLEAKGNVGGRIETHRVPGADWYIELGAMRIPRNHRLSIEFVRK
LGLHLTEFCPCNNQTWVLVNRVRQRFGAVQANPDLLGYVVRAHEAGKTAEQLFEQSLRKV
EEELRSSSCRRVLEKYDSFSTKEYLIKVGNLSRGAVQMIGDLLNADSGYYEAFMETLRGF
IFFFHEPRFYEIIGGFDQLPQALHQALQPGTRFWERDGIHSGRSVTDRPSRFIYYPKHVF
PNGTGVILASYTLDYSFVKNWGRDPHSMGGFTFFTPYQFVDYAKELSQPEGRVHFAGEHT
ALPHGALPTLPPRPDAVSTESAREAAIKTTKHALS
Download sequence
Identical sequences G5C3L0
HGL_H00000342557-2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]