SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000343190 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000343190
Domain Number 1 Region: 16-192
Classification Level Classification E-value
Superfamily Homo-oligomeric flavin-containing Cys decarboxylases, HFCD 2.09e-59
Family Homo-oligomeric flavin-containing Cys decarboxylases, HFCD 0.0000000197
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000343190
Sequence length 204
Comment PPCDC (Homo_sapiens) phosphopantothenoylcysteine decarboxylase
Sequence
MEPRASSPAATPQVERKFHVLVGVTGSVAALKLPLLVSRLLDISGLEVTVVTTERAKHFY
SPQDIPVTLYSDTDEWEMWKRRSDPVLHIDLRRWADLMVVAPLDANTLGKVASGICDNLL
TCVIRAWDHSKPLFFCPAMNTAMWEHPLTAQQVGQLKAFGYTEVPCVAKKLVCGDQGMGA
MAEVETIIDKVKEVFSQHRGIQQS
Download sequence
Identical sequences G5AL72
HGL_H00000343190

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]