SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000343464-2 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000343464-2
Domain Number 1 Region: 9-66
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000000000288
Family HLH, helix-loop-helix DNA-binding domain 0.003
Further Details:      
 
Domain Number 2 Region: 81-124
Classification Level Classification E-value
Superfamily Orange domain-like 0.00000000314
Family Hairy Orange domain 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000343464-2
Sequence length 281
Comment HELT (Homo_sapiens) HES/HEY-like transcription factor
Sequence
MQELLSSRRTPVSHKVIEKRRRDRINRCLNELGKTVPMALAKQSSGKLEKAEILEMTVQY
LRALHSSDFLRGREKAELLAEFANYFHYGYHECMKNLVHYLTTVERMETKDTKYARILAF
LQSKARLGAEPAFSPLASLPEPDFSYQLHSAGPEFAGHTPSEAAVFPQGAAPGTFPWPHG
AARNPALPYLPSAPVPLSSPAQQHSPFLAPVQGLDRHYRPHPPQRPQPAHAPASPSDATP
SARRLAALGRRLGDVYILYMCKYCVHTKPGVGEKTKSEIVF
Download sequence
Identical sequences G5B2X2
HGL_H00000343464-2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]