SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000343948 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000343948
Domain Number 1 Region: 458-526
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000000000484
Family HLH, helix-loop-helix DNA-binding domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000343948
Sequence length 618
Comment TFEB (Homo_sapiens) transcription factor EB
Sequence
MQRPGPAQIPQAVGGYEAQSVQFPTPTGPLAQGSSSGILGLLGVQSTLQGFSGARQPCCS
GDRAFLCMLGLLLVTWEAGLEGPALCFRSVTLDVSCHPAESPCPLAQCHFLEAGGLSSQR
LLRPRCRVARSMAQLSSQLAPWLWTSPFPSEGSVSPPAPWEPLHAYQLLAQGDGEGAQCL
TGRCPCALREPVATMASRIGLRMQLMREQAQQEEQRERRQQAAVVQXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSPAISTPVPFQPPPPVPGEVLK
VQSYLENPTSYHLQQSQHQKVREYLSETYGNKFAARVSPAQGSPKPPPAASPGVCAGHVL
STSAGNSTPNSPMAMLHIGSNPEKEFDDVIDNIMRLDNVLGYMNPELQMPNTLPLSSSHL
NVYSSDPQVTASLVGVTSSSCPADLTQKQELTDAESRALAKERQKKDNHNLIERRRRFNI
NDRIKELGMLIPKANDLDVRWNKGTILKASVDYIRRMQKDLQKSRELESHSRRLEMTNKQ
LWLRIQELEMQARVHGLPTTSPSGVNMAELAQQVVKQELPNDSLLPLASDPLFSTMSPEA
SKASSRRSSFSMEEGDVL
Download sequence
Identical sequences G5BNI2
HGL_H00000343948

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]