SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000344866 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000344866
Domain Number 1 Region: 271-370,437-456,529-625
Classification Level Classification E-value
Superfamily RNI-like 2.59e-25
Family Cyclin A/CDK2-associated p19, Skp2 0.076
Further Details:      
 
Domain Number 2 Region: 139-207
Classification Level Classification E-value
Superfamily F-box domain 8.24e-19
Family F-box domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000344866
Sequence length 636
Comment FBXL5 (Homo_sapiens) F-box and leucine-rich repeat protein 5
Sequence
MHEQIENEYIIGLLQQRSQTIYNVHSDNKLSEMLSLFEKGLKNVKNEYEQLNYAKQLKER
LEAFTRDFLPHMKEEEEVFQPMLMEYFTYEELKDIKKKVIAQHCSQKDTAELLRGLSLWN
QAEERQKFFKYSVDEKSDTEAEVSEHSTGITHLPPEVMLSIFSYLNPQELCRCSQVSTKW
SQLAKTGSLWKHLYPVHWARGDWYSGPATELDTEPDEEWVKSRQDESRAFQEWDEDADRD
ESEESAEELTAISIAQMEKRLLHGLIHNVLPYVGTSVKTLVLAYSSAVSSKMVRQILELC
PNLEHLDLTQTDISDSAFDSWSWLGCCQSLRHLDLSGCEKITDVALEKISRALGILASHQ
NDFLKTTASKITSTKWKNKDITMQSTKQYSCLHDLTHKGIAEEIDNEHSWTKPVSSESFP
SPYVWMLDAEDLADIEDAVEWRHRNVESLCVMETASNFGCSSSGCYSKDIVGLRTSVCWQ
QHCASPAFAYCGHSFCGTGAALRTMSALPESSAMCRKALRTTLPRGKDFLDLGSEKSDQE
TGRVLLFLSLSGCYQITDHGLRVLTLGGGLPYLEHLNLSGCLTVTGAGLQDLVSACPSLN
DEYFYYCDNINGPHADTASGCQNLQCGFRACCRSGE
Download sequence
Identical sequences G5BGC1
HGL_H00000344866

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]