SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000345771 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000345771
Domain Number 1 Region: 396-807
Classification Level Classification E-value
Superfamily Phosphofructokinase 1.02e-110
Family Phosphofructokinase 0.0000074
Further Details:      
 
Domain Number 2 Region: 72-394
Classification Level Classification E-value
Superfamily Phosphofructokinase 1.44e-105
Family Phosphofructokinase 0.000000319
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000345771
Sequence length 836
Comment PFKM (Homo_sapiens) phosphofructokinase, muscle
Sequence
MSQRHDSAVPTQLGEASTSSMLIPKLRPKTDTLESLDTVDDPDPMEGIPVFKTEWIMTNE
EHHAAKTLGIGKAIAVLTSGGDAQGMNAAVRAVVRVGIFTGARVFFVHEGYQGLVDGGDH
IREATWESVSMMLQLGGTVIGSARCKDFREREGRLRAAHNLVKLGITNLCVIGGDGSLTG
ADTFRSEWSDLLSDLQKAGKITAEEAKKSSFLNIVGLVGSIDNDFCGTDMTIGTDSALHR
IIEIVDAITTTAQSHQRTFVLEVMGRHCGYLALVTSLSCGADWVFIPECPPDDDWEEHLC
RRLSETRTRGSRLNIIIVAEGAVDKNGKPVTSEDIRNLVVKRLGYDTRVTVLGHVQRGGT
PSAFDRILGSRMGVEAVMALLEGTPDTPACVVSLSGNQAVRLPLMECVQVTKDVTKAMDD
KRFDEAMKLRGRSFMNNWEVYKLLAHVRPPVSKTGAFTVAVMNVGAPAAGMNAAVRSTVR
IGLIQGNRVLVVHDGFEGLAKGQIEEAGWSYVGGWTGQGGSKLGTKRTLPKKSLEQISAN
ITKFNIQGLVIIGGFEAYTGGLELMEGRKQFDELCIPFVVIPATVSNNVPGSDFSIGADT
ALNTICTTCDRIKQSAAGTKRRVFIIETMGGYCGYLATMAGLAAGADAAYIFEEPFTIRD
LQANVEHLVQKMKTTVKRGLVLRNEKCNENYTTDFIFNLYSEEGKGIFDSRKNVLGHMQQ
GGSPTPFDRNFATKMGAKAMNWMSGKIKESYRNGRIFANTPDSGCVLGMRKRALVFQPVT
ELQEQTDFEHRIPKEQWWLKLRPILKILAKYEIDLDTSDHAHLEHISGKRSGEATV
Download sequence
Identical sequences G5BWB9
HGL_H00000345771

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]