SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000345841 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000345841
Domain Number 1 Region: 385-424
Classification Level Classification E-value
Superfamily SAP domain 0.000000000568
Family SAP domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000345841
Sequence length 1086
Comment MKL2 (Homo_sapiens) MKL/myocardin-like 2
Sequence
MIDSSKKQQQGFPEILTTGDFEPFKEKECLEGSNQKSLKEVLQLRLQQRRTREQLVDQGI
MPPLKSPAAFHEQIKSLERARTENFLKHKIRSRPDRSELVRMHILEETFAEPSLQATQMK
LKRARLADDLNEKIAQRPGPMELVEKNILPVDSSVKEAIIGVGKEDYPHTQGDFSFDEDS
SDALSPDQPASQESQGSVASPSEPKVSEAPSPVTTNTPAQFTSVSPAVPEFLKTPPNVDQ
LPTRSTAPVLPTNTVSSAKPSPTLVKQSHPKNPNDKHRSKKCKDPKPRVKKLKYHQYIPP
DQKGEKNEPQMDSNYARLLQQQQLFLQLQILSQQQQHYNYQAILPAPTKNDKNNNSGNSS
LNNTMPNTPRQNTSAPVRKPGPLPSSLDDLKVSELKTELKLRGLPVSGTKPDLIERLKPY
QEVNSSGLAAGNIVTVSSSAIVTSNPEVTMALPVTTLHNVVTSSVPTFKAEMPSAVPGNV
AHAENLHSPLPVSPSPSEQSSLSTDDTTMADTFTEIMTMMSPSRFLCSSPLRVANHEDSL
SPTSSTLSNLELDAAEKDRKLQEKEKQIEELKRKLEQEQKLVEVLKMQLEVEKRGQQQQR
PPEPQPSTPVHSASTSNQKHGSIGSSVKDEASLPECSSPRQPIQAPGHCVGQPISTSAQT
LVAKKAIVIKQELPVAQAEQQSVVSQFYVSSQGQPPTVVAPPQALLTTQTAQLLLPVSIQ
GSSVTSVQLPVGSLKLQTPPQAGIQTQPQIATATPVPAAALPSGLAPTAPQKQDAFPQHV
VSQPQQVRKVFTSSAPNPVLPYPRQSAPAVQQPFVAKTSNSVLQSRTTPLPSLQNGTNTS
SKPSSSPPPQQFVVQHSLFGTSVTKTKDPPRYEEAIKQTRSAQSSLPEISNAHSQQMDDL
FDILIKSGEISLPIKEEPSPISKMRPVTASITTMPVNTVVSRPPPQVQMAPPVSLEPMSS
LSASLENQLEAFLDGTLPSANEIAPLQSSSEDREPFSLIEDLQNDLLSHSSMLDHSHSPM
ETSEAQFAAGTPCLSLDLSDSNLDNMEWLDITMPNTSSGLTPLSATAPSMFSADFLDPQD
LPLPWD
Download sequence
Identical sequences G5B4F2
XP_004855902.1.39548 HGL_H00000345841

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]