SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000346325 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000346325
Domain Number 1 Region: 529-560,645-718
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000000000961
Family Anti-sigma factor antagonist SpoIIaa 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000346325
Sequence length 753
Comment SLC26A5 (Homo_sapiens) solute carrier family 26, member 5 (prestin)
Sequence
MDHAEENEIPAATQKYYVERPIFSHPVLQERLHEKDKVSDSIGDKLKQAFTCTPKKIRNI
IYMFLPITKWLPAYKFKEYVLGDLVSGISTGVLQLPQGLAFAMLAAVPPVFGLYSSFYPV
IMYCFLGTSRHISIGPFAVISLMIGGVAVRLVPDDIVIPGGGNATNGTEARDALRVKVAM
SVTLLSGIIQFCLGVCRFGFVAIYLTEPLVRGFTTAAAVHVFTSMLKYLFGVRTKRYTGI
FSVVYSTVAVLQNVKNLNVCSLGVGLMVFGLLLGGKEFNERFKEKLPAPIPLEFFAVVMG
TGISAGFNLQESYNVDVVGTLPLGLLPPANPDTSLFHLVYVDAIAIAIVGFSVTISMAKT
LANKHGYQVDGNQELIALGLCNSIGSLFQTFSISCSLSRSLVQEGTGGKTQLAGCLASLM
ILLVILATGFLFESLPQAVLSAIVIVNLKGMFMQFSDLPFFWRTSKIELTIWLTTFVSSL
FLGLDYGLITAVIIALLTVIYRTQSPSYKVLGQLPDTDVYVDTDAFEEVKEIPGIKIFQI
NAPIYYANSDLYSNALKRKTRVNPARIMGARRKAMRKYAKEVGNANVANATVVKANSGLV
SFLIQDAKVDGQDGTKPEEEDGEVKYPPIVIKNTFPEELQRFMPPGDNIHTVILDFTQVN
FIDSVGVKTLAGIVKEYGDVGIYVYLAGCSAQVVNDLTRNRFFENPALKELLFYSIHDAV
LGSQLREALAEQEASAAPLQEDLEPNATPATPE
Download sequence
Identical sequences G5BI49
HGL_H00000346325

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]