SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000346725 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000346725
Domain Number 1 Region: 319-411
Classification Level Classification E-value
Superfamily BRCT domain 2.04e-16
Family DNA-repair protein XRCC1 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000346725
Sequence length 590
Comment PES1 (Homo_sapiens) pescadillo homolog 1, containing BRCT domain (zebrafish)
Sequence
MGGLEKKKYERGSATNYITRNRARKKLQLSLPDFRRLCILKGIYPHEPKHKKKVNKGSTA
ARTFYLIKDIKFLLHEPIVNKFREYKVFVRKLRKAYGKSEWNTVERLKDNKPNYKLDHII
KERYPTFIDALRDLDDALSMCFLFSTFPRTGKCHVQTIQLCRRLTVEFLHYIIAARALRK
VFLSIKGIYYQAEVLGQPIVWITPYAFSHDHPTDVDYRVMATFTEFYTTLLGFVNFRLYQ
SLNLHYPPKLEGQIQAEVKPREDVYALDSENSMEKLAALSASLARVVVPAAEEEAEADDE
MAVQEEDRRKELEAQEKHKKLFEGLKFFLNREVPREALAFIIRSFGGDVSWDKSLCIGAT
YDVTDSQITHQIVDRPGQQTPVIGRYYMQPQWVFDCVNARLLLPVAEYFPGVRLPPHLSP
FVSEKEGDYIPPEKLKLLALQRGEDPGNLKASEEEEEEEEEEEEDRKHNEGDGDEAGENE
EEEEEEVAGSEEEEEAHLAALEQQRIEEKKPRVMAGTVKLEDRQRLAQEEESEAKRLAIM
MMKKREKYLYQKIMFGKRRKIREANKLAQKRKAHDEALRSEKKAKKTRPV
Download sequence
Identical sequences G5AVP2
HGL_H00000346725

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]