SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000346850 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000346850
Domain Number 1 Region: 48-129
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000000173
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0046
Further Details:      
 
Domain Number 2 Region: 323-370
Classification Level Classification E-value
Superfamily RING/U-box 0.000000124
Family RING finger domain, C3HC4 0.019
Further Details:      
 
Domain Number 3 Region: 267-303
Classification Level Classification E-value
Superfamily SAP domain 0.0000229
Family SAP domain 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000346850
Sequence length 376
Comment RNF34 (Homo_sapiens) ring finger protein 34
Sequence
QAGATSMWASCCGLLNEVMGTGVVRGQQSGFPGATGPFRFTTNSDFSAYPPAAAEGPNIV
CKACGLAFSVFRKKHVCCDCKKDFCSVCSISQENHRRCSTCHLLQETAFQRPQLMRLKVK
DLRQYLILRNIPTDTCREKEDLVDLVLCHHGLGSEDDPDTSSLNSSRSQTSSFFTESLFS
HYTAPSTTESFLGELAGRGHTSRSGALAQAQSEAAANTEDDDDEDDDEEEEEEEEEDEDE
ENLEEQTSGLSQKRARASLSDLSSLEEVEGMSVRQLKEILARNFVNYSGCCEKWELVEKV
NRLYKENEENQKSYGERLQLQDDEDDSLCRICMDAVIDCVLLECGHMVTCTKCGKRMSEC
PICRQYVVRAVHVFKS
Download sequence
Identical sequences G5AWN1
HGL_H00000346850

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]