SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000347046 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000347046
Domain Number 1 Region: 289-610
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 5.07e-109
Family PDEase 0.000000000013
Further Details:      
 
Domain Number 2 Region: 80-284
Classification Level Classification E-value
Superfamily GAF domain-like 1.59e-37
Family GAF domain 0.00053
Further Details:      
 
Domain Number 3 Region: 1-94
Classification Level Classification E-value
Superfamily GAF domain-like 3.43e-22
Family GAF domain 0.0005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000347046
Sequence length 628
Comment PDE5A (Homo_sapiens) phosphodiesterase 5A, cGMP-specific
Sequence
DPRFNAEVDQITGYKTQSILCMPIKNHREEVVGVAQAINKKSGNGGTFTEKDEKDFAAYL
AFCGIVLHNAQLYETSLLENKRNQVLLDLASLIFEEQQSLEVILKKIAATIISFMQVQKC
TIFIVDEDCSDSFSSVFHMECEELDKACDTLARECDANNINYMYAQYVKNTMEPLNIPDV
SKDKRFLWTNENMGNVNQQCIRSLLCTPIKNGKKNKVIGVCQLVNKMEENSGKVKPFNRN
DEQFLEAFVIFCGLGIQNTQMYEAVERAMAKQMVTLEVLSYHASAAEEETRELQSLAAAV
VPSAQTLKITDFSFSDFELSDLETALCTIRMFTDLNLVQNFQMKYEVLCRWILSVKKNYR
KNVAYHNWRHAFNTAQCMFAALKAGKIQNKLTDLEILALLIATLSHDLDHRGVNNSYIQR
SEHPLAQLYCHSIMEHHHFDQCLMILNSPGNQILSGLSIEEYKTTLKIIKQAILATDLAL
YIKRRGEFFELIRKNQFNLEDPHQKELFLAMLMTACDLSAITKPWPIQQRIAELVATEFF
DQGDRERKELNIEPTDLMNREKKNKIPSMQVGFIDAICLQLYEALTHVSEDCMPLLDGCR
KNRQKWQALAEQQEKIMVNGENSQAKQN
Download sequence
Identical sequences G5B6A8
HGL_H00000347046

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]