SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000347821 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000347821
Domain Number 1 Region: 47-162,208-293
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 2.38e-20
Family DNA gyrase/MutL, N-terminal domain 0.021
Further Details:      
 
Weak hits

Sequence:  HGL_H00000347821
Domain Number - Region: 759-795,835-875
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0356
Family ABC transporter ATPase domain-like 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000347821
Sequence length 934
Comment MORC4 (Homo_sapiens) MORC family CW-type zinc finger 4
Sequence
MLLYRGAPGGPSASGGGLTRAGGGPQAFGIRLSTMSPRYLQSNSSSHTRPFSAIAELLDN
AVDPDVSARTVFIDVEEVKNKSCLTFTDDGCGMTPHKLHRMLSFGFTDKVIKKSQCPIGV
FGNGFKSGSMRLGKDALVFTKNGGTLTVGLLSQTYLECVQAQAVIVPIVPFNQQNNILSG
NGECCLEAILNYSIFNSENDLLSQFDAIPGKKGTRVLIWNIRRNKDGKSELDFDTDQYDI
LISDIDAEEKETDGIASELPETEYSLRAFCSILYMKPRMKIFLRQKKVTTQMIAKTLSNV
GYDIYKPTFTNKQVRITFGFSCKKSNHFGVMMYHNNRLIKSFEKVGCQVKPTHGEGMGVI
GVIECNFLKPAYNKQDFEYTKEYRVTINALAQKLNAYWKEKTSQENFETSAVTRPVTKIP
DQTWVQCDECLKWRKLPDQVDPSALPARWFCYYNSHPKYRRCSVPEEQELIDEDLYLTKA
KKQDQTVEKKMPMENETYQVLSNLPKIPTVQDMAGLNDKTIGYEGMNAPSLLPCVGEESQ
SPSLQLKPLDSSVFQFSSKYKRILGEEPVEKRKRLQNEMTASPIDYSMHGSYRRVEAVVA
YPERENSYDKSSSERSTPPYLFPEYPEASKNTGHNREVSVLCPGAQDQCQGSLLPEELED
QMPRLVAEESNRSSTCINKEDVNKGPFVAVVGVAKDVTDSGAPIQLIPFNREELAERRKA
VESWNPVPYSSVASATISAVAIGEKRRGRKETRGHNTPKMNNQSELEELKRTTEKLERVL
AERNLFQQKVEELEQEKNHWHSEFKKVQHELVTYSTQETEGLYWSRKHMGYRQAEFQILK
AELERTKEEKQELKEKLKETQTHLEVLQKTQVSYRTPEGDDLERALAKLTRLRIYVSYLL
TSVLPHLELREIGYDSEQVDGILYTVLEANHILD
Download sequence
Identical sequences G5C3Z3
HGL_H00000347821

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]