SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000348020 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000348020
Domain Number 1 Region: 2-216
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 3.27e-35
Family DNA gyrase/MutL, N-terminal domain 0.001
Further Details:      
 
Domain Number 2 Region: 1193-1407
Classification Level Classification E-value
Superfamily DNA mismatch repair protein MutL 2.09e-24
Family DNA mismatch repair protein MutL 0.01
Further Details:      
 
Domain Number 3 Region: 195-349
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.12e-16
Family DNA gyrase/MutL, second domain 0.0033
Further Details:      
 
Weak hits

Sequence:  HGL_H00000348020
Domain Number - Region: 1045-1076
Classification Level Classification E-value
Superfamily WW domain 0.00989
Family WW domain 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000348020
Sequence length 1458
Comment MLH3 (Homo_sapiens) mutL homolog 3 (E. coli)
Sequence
MIKCLSVEVKAKLRSGLAINSLGQCVEELALNSIDAEAKCVAIRVNMETFQVQVIDNGFG
MGSDDIDKVGHRYFTGKCHSVQDLENPRFYGFRGEALASIADLASAVEISSKKNRTMKTF
VKLFQNGRALKACEADLTRPSAGTTVTVYNLFYQLPVRRKCLDPRLEFEKIRQRVEALSL
MHPSISFSLRNDVSGSMVLQLPKTKDVCSRFCQIYGLGKSQKLKEIHFRYKEFELSGYIS
SEAHYNKNMQFLFVNRRLILRTKLHKLIDFLLRKESIICKPKNGSASRQMNSSPRHRSTP
ELHGIYVINVHCQFCEYDVCMEPAKTLIEFQNWDTLLICIQEGVKMFLKQEKLFMELSGE
DIKEFSEDNDFSLFGTSLQKHMFSDEKHDQGSFQEACNNILDSYEMFNLQSKAVKRKATI
ENINTQNSRDSQAIRKKTDVSSLSACELDSLDHSKMTELSLFNTDSSSLASRMLEQGTVE
TSELRENEKHKISCLDYNSLESPCGKSLEMFLSLSHTQQYFEENGSDLEIQKVSTLVNGM
AANVLKNNRTQNQLERCKDAAEMRCQPVSFGTSLRVHSTQREKEKGKKEPNDCGRINIFS
YGQVKLCSTGFITHVVQNEQTKSTEAEHSFKNYVRPGPAYAQEIFGNRIDHSVETPDIKD
LTSTLSKKSAHLPNKKFCRTNTSYGLANKHIATYKNFAVVQEGTKEAHTSCLLPDTSSSF
PWHKHVSNNSKKTDTLITSSKTIVCKKLSLSSQLGSLEKFKRLYGKVKNPLDTEVEEKNS
EVTTSLSPQVEPDISLKAKNPLDNSDVCKITTVKHNDSNNSCQPVSHIMYSEKFPFSKEE
DCLEQQMPCLRESPITLTELLHSNRKLLNVEKLPESLATKLSRLKDSEKETQMMETMRHF
NEFPNSDPSRKDSDLCSRLVLDFCQLFKNDHEKIESGIIPVVDSVMQDNSFNNNSETHSN
SNTAENLMISETPLVLTHNDVKLIKDADILIRASEQQIESPDSHSRMLISLAENTTVDQN
GVCSPSKDSEARACSENEESNNCSSDWEQHFDVALGRMVYINKMTGLSTFVAPTKDVKTA
CTKDLTTMAVDVILGNGSQYRCHPFRSDLILPFLPRAREERTVMRQNNTDAVDDAVGCNE
SLQSLLSEWDNPVFSRYPEVAVDVSSGQAESLAVKIHNILYPYRFTKEMIHSMQVLQQVD
NKFIACLMSTKTGENGEGGGNLLILVDQHAAHERIRLEQLITDSCEKQQPQGCGRKKLLS
STIIPPLDITVTEEQRRLLWCYHKNLEDLGLEFTFPDTSDSLVLVGKVPLCFVEREANEL
RRGRSTVTKSIVEEFIREQVELLQTTGGIQGTLPLTVQKVLASQACHGAIKFNDHLSPEE
SYRLIEALSWCQLPFQCAHGRPSMLPLADLDHLEQEKQTKPNLAKLRKMAQAWHLFGKAE
SCDMKQSLQQSMPPCERP
Download sequence
Identical sequences G5C1L2
HGL_H00000348020 XP_004837238.1.39548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]