SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000349393 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000349393
Domain Number 1 Region: 204-452
Classification Level Classification E-value
Superfamily DNA ligase/mRNA capping enzyme, catalytic domain 4.32e-47
Family ATP-dependent DNA ligase catalytic domain 0.00073
Further Details:      
 
Domain Number 2 Region: 459-604
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 4.97e-33
Family DNA ligase/mRNA capping enzyme postcatalytic domain 0.00058
Further Details:      
 
Domain Number 3 Region: 620-748
Classification Level Classification E-value
Superfamily BRCT domain 7.72e-20
Family DNA topoisomerase II binding protein 1, TopBP1 0.062
Further Details:      
 
Domain Number 4 Region: 9-253
Classification Level Classification E-value
Superfamily ATP-dependent DNA ligase DNA-binding domain 0.000000000000017
Family ATP-dependent DNA ligase DNA-binding domain 0.0097
Further Details:      
 
Domain Number 5 Region: 832-911
Classification Level Classification E-value
Superfamily BRCT domain 0.0000000000596
Family DNA ligase 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000349393
Sequence length 911
Comment LIG4 (Homo_sapiens) ligase IV, DNA, ATP-dependent
Sequence
MAASQTSQTVASHVPFADLCSTLERMQKSKGRAEKIRHFKEFLDSWRKFHAALHKNQKDV
TDSFYPAMRLILPQLERERMAYGIKETMLAKLYIELLNLPREGKDALKLLNYRTPTGTRG
DAGDFAVIAYFVLKPRCLQKGSLNIQQVNELLDSIASNNSARKKDLVKKSLLQLITQSSA
LEQKWLIRMIVKDLKLGFSEKTIFSVFHNDAAELHNVTTDLEKVCRQLHDPSVGLSDISI
TLFSAFKPMLAAIADIEHIEKDMKHQSFYIETKLDGERMQMHKDGDVYQYFSRNGYNYTE
QFGASPSEGSLTPFIYNAFKPDVQICILDGEMMAYNPNTQTFMQKGNKFDIKRMVEDSDL
QTCYCVFDVLMVNNKKLGRETLRKRYEILNSIFTPVSGRMEVIQKAQAHTKKEVIDALNE
AIDKREEGIMIKHPLSIYKPDKRGEGWLKIKPEYVNGLMDELDILIVGGYWGKGSRGGMM
SHFLCAVAEKPPPGEKPAVFHTLCRVGSGYTMKELYDLGLKLAKHWKPFQKKAPPSSILC
GTEKPEVYIEPRNSVIVQIKAAEIVPSEMYKTSCTLRFPRIEKIRDDKEWHECMTLDELE
QLRGKASGKLASKHLYVGSDDEPKEKKRKAAPKMKKVIGILENLKAPNLSNISKVSNIFE
DVEFCVMSGTDSHSKLDLENRIAELGGYIVQNPGPDTYCVIAGLENIRVRNIVSSDKHDV
VRPAWLLECFKTKTCLPWHPRFMIHMCPSTRQHFAREYDRYGDSYFVDTDLNQLKEVFSG
IKNSNAQTPKEMAPVIADLEYRYSWDRSSLSMFRHHTVYLDLYTVINDLSTKIEGTRLAI
VALELRFHGAKVVSCLAEGVSHVIVGEDQSRVADFKAFRRSLKKKFKILRECWVTDSIDK
CELEEESQYWI
Download sequence
Identical sequences G5B8M6
HGL_H00000349393 XP_004858619.1.39548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]