SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000349996 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000349996
Domain Number 1 Region: 1-170
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 4.06e-66
Family Inorganic pyrophosphatase 0.00000329
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000349996
Sequence length 176
Comment PPA2 (Homo_sapiens) pyrophosphatase (inorganic) 2
Sequence
TWEDPHHKDKDTGCCGDNDPIDVCEIGSKVLSRGEVVPVKILGVLALIDQGETDWKLIAI
NANDPEADKFHDIDDVQKFKPGYLEATVHWLRFYKVPEGKPENKFAFSGEFKNKAFALEV
IKSAHECWKVLLMKKCDGGAINCTNAQVCDSPFRCTQEEARSLVESVRSKCAQDVF
Download sequence
Identical sequences G5AKN2
HGL_H00000349996

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]