SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000351273 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000351273
Domain Number 1 Region: 223-433
Classification Level Classification E-value
Superfamily Caspase-like 4.34e-69
Family Caspase catalytic domain 0.000000111
Further Details:      
 
Domain Number 2 Region: 41-152
Classification Level Classification E-value
Superfamily DEATH domain 3.94e-30
Family DEATH effector domain, DED 0.0034
Further Details:      
 
Domain Number 3 Region: 139-221
Classification Level Classification E-value
Superfamily DEATH domain 1.47e-20
Family DEATH effector domain, DED 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000351273
Sequence length 435
Comment CASP8 (Homo_sapiens) caspase 8, apoptosis-related cysteine peptidase
Sequence
MAEPGPFAKGQASGRYSPSSPEHSTVFWPRSELFHYLLRSMDFSTCLYNIGEQLDSDELA
SLKFLSLEHIPQRKQESITDAWMLFQRLQENRVLEEGNLSFLKELLFRISRLDLLAACLS
TSREEMEQQLGTPGKAQISTYRVMLLRIAEDVTSQELKNFKFLLHREIPKCKLDDSMSLL
DIFIEMEKRVILGKEKLDTLKSICEQVNRSLLLKISDYEALHGETLEGTFTELHFETVPC
RNFTAQTICDMLQHYQGVDHGDRDCFICCVLSHGNSGIVYGTDGQEVPISELTSYFTGSK
CPSLAGKPKVFFIQACQGEKCQKAVCVESDSDENEAYLHEDLAFPCKAIPDEADFLLGMA
TVDSCVSYRDPTKGTWYIQTLCKSLRRRCPQGDDVLTILTEVNFEVGKKINPKNMGKQMP
QPTFSLRKKLFFPID
Download sequence
Identical sequences HGL_H00000351273

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]