SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000351490-1 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000351490-1
Domain Number 1 Region: 23-102
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 8.72e-21
Family HLH, helix-loop-helix DNA-binding domain 0.00000571
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000351490-1
Sequence length 160
Comment MAX (Homo_sapiens) MYC associated factor X
Sequence
MSDNDDIEVESDEEQPRFQSAADKRAHHNALERKRRDHIKDSFHSLRDSVPSLQGEKASR
AQILDKATEYIQYMRRKNHTHQQDIDDLKRQNALLEQQVRALEKARSSAQLQTNYPSSDS
SLYTNAKGSTISAFDGGSDSSSESEPEEPQSRKKLRMEAS
Download sequence
Identical sequences G5BD09
HGL_H00000351490-1 XP_004837445.1.39548 XP_005212097.1.76553 XP_005909828.1.15283 XP_005961623.1.78601 XP_006072189.1.26621 XP_010845058.1.44457 XP_011971114.1.54773 XP_012037231.2.66739 XP_017909550.1.57651 XP_019824634.1.53367 XP_020734849.1.74333

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]