SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000352565 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000352565
Domain Number 1 Region: 45-108
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 2.36e-18
Family HLH, helix-loop-helix DNA-binding domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000352565
Sequence length 165
Comment HAND2 (Homo_sapiens) heart and neural crest derivatives expressed 2
Sequence
MSPPDYSMALSYSPEYASGAAGLDHSHYGGVPPGAGPPGLGGPRPVKRRGTANRKERRRT
QSINSAFAELRECIPNVPADTKLSKIKTLRLATSYIAYLMDLLAKDDQNGEAEAFKAEIK
KTDVKEEKRKKELNEILKSTVSNNDKKTKGRTGWPQHVWALELKQ
Download sequence
Identical sequences G5B403
HGL_H00000352565

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]