SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000353794 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000353794
Domain Number 1 Region: 59-175
Classification Level Classification E-value
Superfamily RNI-like 0.000000000294
Family Cyclin A/CDK2-associated p19, Skp2 0.025
Further Details:      
 
Domain Number 2 Region: 2-91
Classification Level Classification E-value
Superfamily F-box domain 0.0000000379
Family F-box domain 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000353794
Sequence length 328
Comment FBXL22 (Homo_sapiens) F-box and leucine-rich repeat protein 22
Sequence
MHITQLNHECLLHLFSFLDKDSRKSLARTCSQLHDVFEDPALWPLLHFRSLTELKKDNFR
LGPALRSLSICWHSSRVQVCSVEDWLKSALQRSLCSQHESLVSDFLLQVCDRCPNLTSVT
LSGCGHVTDDCLARLLLCCPRLRALRLENCARVTNGTLVAVAAHGRALQTLHVDFXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXPAPFARSLPSPHPARRAQRGHDPRPSAARARRPVHAVAALGPDPGA
RASDAHVWPGSGFRMRRGYNACLPRGVV
Download sequence
Identical sequences G5AVW8
HGL_H00000353794

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]