SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000353826 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000353826
Domain Number 1 Region: 413-690
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.02e-50
Family Extended AAA-ATPase domain 0.0045
Further Details:      
 
Domain Number 2 Region: 696-881
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.93e-49
Family ATP-dependent protease Lon (La), catalytic domain 0.0000133
Further Details:      
 
Domain Number 3 Region: 8-110
Classification Level Classification E-value
Superfamily PUA domain-like 0.00000000000273
Family LON domain-like 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000353826
Sequence length 895
Comment LONP1 (Homo_sapiens) lon peptidase 1, mitochondrial
Sequence
MTIPDVFPHLPLIAITRNPVFPRFIKIVEVKNKKLVELLRRKVRLAQPYVGVFLKRDDNN
ESDVVESLDEIYHTGTFAQIHEMQDLGDKLRMIVTGHRRIHINRQLEVEPEEAELENRQK
PRRKAKRGKKEAEDELSPSTPREVGQEPATEAAGEVLMVEVENVVHEDFQVTEEVKALTA
EIVKTIRDIIALNPLYRESVLQMMQAGQRVVDNPIYLSDMGAALTGAESHELQDVLEEAN
IPKRLYKALSLLKKEFELSKLQQRLGREVEEKIKQTHRKYLLQEQLKIIKKELGLEKDDK
DAIEEKFRERLRELVVPKHVMDVVDEELSKLGLLDNHSSEFKHCPPALGTPVSPMPTAAP
DWSPQSSLWLLQIRAGSALDVLEGLSQHILVTRNYLDWLTSVPWGRHSDENLDLSRAQAV
LEEDHYGMEDVKRRILEFIAVSQLRRSTQGKILCFYGPPGVGKTSIARSIARALNREYFR
FSVGGMTDVAEIKGHRRTYVGAMPGKIIQCLKKTKTENPLVLIDEVDKIGRGYQGDPSSA
LLELLDPEQNANFLDHYLDVPVDLSKVLFICTANVTDTIPEPLRDRMEMINVSGYVAQEK
LAIAERYLVPQARALCGLDESRARLSAPVLTLLIKQYCRESGVRNLQKQVEKVLRKAAYK
IVSGEAETVEVTPENLQDFVGKPVFTVERMYDATPPGVVMGLAWTALGGSTLFVETSLRR
PRDRDSKENKDGSLEVTGQLGDVMKESARIAYTFARAFLLQRDPSNDYLVTSHIHLHVPE
GATPKDGPSAGCTIVTALLSLALDQPVQQDLAMTGEVSLTGKILPVGGIKEKTIAAKRAG
VTCIVLPAENKKDFYDLAAFITEGLEVHFVEHYSQVFDIAFPVPQRHAEALAVER
Download sequence
Identical sequences G5C0Q5
HGL_H00000353826

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]