SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000354476-2 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000354476-2
Domain Number 1 Region: 329-399
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 2.49e-19
Family HLH, helix-loop-helix DNA-binding domain 0.0000519
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000354476-2
Sequence length 1143
Comment SREBF2 (Homo_sapiens) sterol regulatory element binding transcription factor 2
Sequence
MDESGELGGLETMETLTELGDELTLGDIDEMLQFVSNQVGEFPDLFSEQLCSSFPGGGGS
GGSGGGGNGSGNSSSNNGRGSSGGAVDPSMQRSFSQVPLSSFSPSAPSPQAAALQVKVPP
PAVPTPPRATPVLQPRPQPQPQPPAQLQQQTVMITPTFSTAPQTRIIQQPLIYQNAATSF
QVLQPQVQSLVTSSQVQPVTIQQQVQTVQAQRVLTQTANGTLQTLAPATVQTVAAPQVQQ
VPVLVQPQIIKTDSLVLTTLKTDGSPVMAAVQNPALTALTTPIQTAALQVPTLVGSSGTI
LTTMPVMMGQEKVPIKQVPGGVKQLEPPKEGERRTTHNIIEKRYRSSINDKIIELKDLVM
GTDAKMHKSGVLRKAIDYIKYLQQVNHKLRQENMVLKLANQKNKLLKGIDLGSLVDNDVD
LKIDDFNQNVLLMSPPASDSGSQAGFSPYSIDSEPGSPLLDDAKVKDEPDSPPVALGMVD
RSRILLCVLTFLGLSFNPLTSLLQWRGAGDSDQHPYSGSSRSMLSFESGSVGWFDWMMPT
LLLWLVNGVIVLSVFVKLLVHGEPVIRPHSRSSVTFWRHRKQADLDLARGDFAAAAANLQ
TCLSVLGRALPTSRLDLACSLSWNVIRYSLQKLRLVRWLLKKVFQRWRATPATAAGFEDE
AKSSARDAALAYHRLHQLHITGKLPAGSPCSDVHMALCAVNLAECAEEKIPPSTLVEIHL
TAAVGLKTRCGGKLGFLANYFLSHAQSLCGLEHSAIPDSLRWLCHPLGQKFFMERSWSVK
SAAKESLYCAQRNPADPIAQVHQAFCKNLLERAVESLVKPQAKKKSGDQEEESCEFSSAL
EYLKLLHSFVDSVGFAAPPFSSSSVFKLALGPDIICRWWTSAVTLAISWLQGDDAAVRSC
FTEVERVPKALEVTESPLVKAIFHACKAMHASLSAKADGQQNSFCYCERASGHLWSSLNV
SEATSDPALNHVVQLLTCDLLLSLRTALWQKQAGASQALGETYHASGTELAGFQRDLGSL
RRLAHSFRPAYRKVFLHEATVRLMAGASPTRTHQLLEHSLRRRTTESTKHGEVDAWPGQR
ERATAILLACRHLPLSFLSSPGQRAVLLAEAARTLEKVGDRRSCSDCQQMIVKLGGGTAI
AAS
Download sequence
Identical sequences G5BPQ5
HGL_H00000354476-2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]