SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000354721 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000354721
Domain Number 1 Region: 536-561,603-683
Classification Level Classification E-value
Superfamily SpoIIaa-like 3.14e-16
Family Anti-sigma factor antagonist SpoIIaa 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000354721
Sequence length 697
Comment SLC26A1 (Homo_sapiens) solute carrier family 26 (sulfate transporter), member 1
Sequence
MESSPEAPQQGKGLVLVRRQPPKPRGRMETLKARLQQSCRCSVPRAWGLVQDLIPATRWL
RQYRPQEYLAGDIMSGLVIGIILVPQAIAYSLLAGLQPIYSLYTSFFANLIYFLLGTSHH
VSVGIFSLLCLMVGQVVDRELQLAGFDPSRDGNSSTVNSSVAMLEPGLQDCGRDCYAIRV
ATALTLMTGIYQVLMGIFRLGFMSTYLSQPLLDGFAMGASVTILTSQLRHLLGVRVPQHQ
GLSMVVRTWLSLLRGLGQANVCDVVTSAVCLSVLLAARELSDRCRHRMKVPLPTELLVIV
VATLVSHFGQLHSRFGSSVAGHIPTGFVPPQAPDLELMWRVALDAVSLALVGSAFSISLA
EMFARSHSYSVRANQELLAVGCCNVLPAFFHCFVTSAALSKTLVKTATGCRTQVSSVVSA
AVVLLVLLALAPLFRDLQRCVLACVIVASLRGALRKVRDLPQLWRLSPADALVWAATAAT
CVLLSVEAGLLAGLLLSLLSLVGRTQRPRAALLARIGDSAFYEDAAEFEGLVPPAGVRVF
RFSGPLCYANKAFFLQSLYSLTGLDAGRLAARRKGQGSELEAGEGDRMEGRDPGSSQARL
VPMVAGFHSVVIDCASLLFLDMAGMAVLQDLRRDYRALGVSLLLACCSPSVRDTLHRGGF
LGEEQEAENKQLFPSVHSAVEAAQAHYGQLVATDSAL
Download sequence
Identical sequences G5BCK0
HGL_H00000354721 XP_004847515.1.39548 XP_004847516.1.39548 XP_004847517.1.39548 XP_004847518.1.39548 XP_012928534.1.39548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]