SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000355011 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000355011
Domain Number 1 Region: 43-123
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 0.0000000067
Family 2'-5'-oligoadenylate synthetase 1, OAS1, N-terminal domain 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000355011
Sequence length 263
Comment ILF2 (Homo_sapiens) interleukin enhancer binding factor 2, 45kDa
Sequence
MRFRPFVPHIPFDFYLCEMAFPRVKPAPDETSFSEALLKRNQDLAPNSAEQQIEEVRQVG
SYKKGTMTTGHNVADLVVILKILPTFLTMLTNETGFEISSSDATVKILITTVPPNLRKLD
PELHLDIKVLQSALAAIRHARWFEENASQSTVKVLIRLLKDLRIRFPGFEPLTPWILDLL
DMVCYTAQTLVRILSHGGFRKILGQEGDASYLASEISTWDGVIVTPSEKAYEKPPEKKEG
EEEEENTEEPPQGEEEESMETQE
Download sequence
Identical sequences HGL_H00000355011

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]