SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000355330 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000355330
Domain Number 1 Region: 170-467
Classification Level Classification E-value
Superfamily Cysteine proteinases 9.65e-121
Family Transglutaminase core 0.0000000000437
Further Details:      
 
Domain Number 2 Region: 3-144
Classification Level Classification E-value
Superfamily E set domains 1.19e-41
Family Transglutaminase N-terminal domain 0.00000123
Further Details:      
 
Domain Number 3 Region: 479-594
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 1.91e-31
Family Transglutaminase, two C-terminal domains 0.00000279
Further Details:      
 
Domain Number 4 Region: 595-695
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 1.81e-28
Family Transglutaminase, two C-terminal domains 0.0000048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000355330
Sequence length 696
Comment TGM2 (Homo_sapiens) transglutaminase 2 (C polypeptide, protein-glutamine-gamma-glutamyltransferase)
Sequence
MAEDLVLERCDLQLEVNGRDHRTADLCRERLVLRRGQPFWLTLHFEGRGYEASVDTLTFS
AVTGPAPSEEAGTKARFSLSDAVDGCAWSASAVDQQDGVLSLLLNTPADAPIGLYRLSLE
ASTGYQGSSFVLGHFTLLFNAWCPGLEMSVKEALLTLSCYMDRILCQFGGFIYQGSAKFI
KSTPWNFGQFEDGILDICLILLDVNPKFLKDAGRDCSRRRSPIYVGRVVSAMVNCNDDQG
VLLGRWDNNYGDGISPMSWIGSVEILRRWKDYGCQRVKYGQCWVFAAVACTVLRCLGVPT
RVVTNYNSAHDQNSNLLIEYFRNESGETEGNKSEMIWNFHCWVESWMTRPDLEPGYEGWQ
ALDPTPQEKSEGTYCCGPVPVRAIKEGNLSIKYDAPFVFAEVNADVVDWIRQEDGSLHKS
INHSLVVGLKISTKSVGRDEREDITHTYKYPEGSEEEREAFTRANHLNKLAEKEEVKEEA
QVDMRIRVGQNMNMGSDFDVFAHINNSTAESRDCRLLLCARTVSYNGVLGPECGTKDLPD
LTLDPFSERSIPLHILYEKYSDYLTECNLIKVRGLLIEPAANSYVLAERDLYLENPEVKI
RVLGEPKQNRKLVAEVSLKNPLPVPLLGCIFTVEGAGLTKEQKSVEVPGPVESGEQVKVR
VDLLPTDVGLHKLVVNFECDRLKAVKGYRNVIIGPP
Download sequence
Identical sequences G5B816
HGL_H00000355330

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]