SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000355339 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000355339
Domain Number 1 Region: 1-204
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 1.51e-66
Family 2'-5'-oligoadenylate synthetase 1, OAS1, N-terminal domain 0.000000255
Further Details:      
 
Domain Number 2 Region: 207-345
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 6.28e-61
Family 2'-5'-oligoadenylate synthetase 1, OAS1, second domain 0.00000171
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000355339
Sequence length 367
Comment OAS1 (Homo_sapiens) 2',5'-oligoadenylate synthetase 1, 40/46kDa
Sequence
MALTNTTAKDLDKFIEDHLLPDTRFRTEVRQAIDMICAFLKERCFRGARHPVRVSKVVKG
GSSGKGTTLRGRSDADLVVFFTNLSSFQEQVSRRGEFITEIRRQLEEYQTHNSKDMFQVT
FKVQNPQWSNPRVLSFELSSHWLTWNTVEFDVLPAYDALGQVSNTKAYRPNPQIYVKLIN
ECTLSHREGEFSTCFTELQKAFVKGQPTKVKSLIRLVKHWYQLCKRNLGSPLPPQYALEL
LTIHAWESGSGKTSFNMAQGFRTVLELVIEYKQLCVYWMEFYDFENPTIGDYLKGQLRKP
RPVILDPADPTGNLGGKDSERWQRLAQEAEAWLSYPCFKLWDGSSAVAVPIAMELCLTVA
LVLDVAV
Download sequence
Identical sequences G5AKV9
HGL_H00000355339

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]