SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000355384 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000355384
Domain Number 1 Region: 476-581
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000491
Family Anti-sigma factor antagonist SpoIIaa 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000355384
Sequence length 606
Comment SLC26A11 (Homo_sapiens) solute carrier family 26, member 11
Sequence
MSSPVDALGQASSPGCNMALSTCCSFSAWQRRLPFLAWLPAYSLQWLKMDCIAGLSVGLT
VIPQALAYAEVAGLPPQYGLYSAFMGCFVYFFLGTSRDLTLGPTAIMSLLVSFYTFHEPA
YAVLLAFLSGCIQLAMGFLRLGLLLDFISCPVIKGFTSAAAITIGFGQIKNLLGLQNIPR
QFFLQVYHTFLNIGETRLGDAVLGLVCMVLLLALKLMRDHMPPAHPEMPPGVQLSRGLVW
TSTTARNALVVSSAALVAYSFEVTGYQPFLLTGEIARGLPPLKAPPFSVTTANGTVSFTE
MVQDMGAGLAVVPLMGLLESISVAKAFASQNSYRVDANQELLAIGLTNTLGSLLSSYPVT
GSFGRTAVNAQSGVCTPAGGLVTGALVLLSLDYLTSLFYYIPKAALAAVIIMAVAPLFDT
KIFGSLWQVKRLDLLPLCATFLLCFWEVQYGILAGTLVSVLLLLHSVARPKIQVSEGPVL
VLQPTSGLHFPATEALRDSVLSQALGGASSPRSAVLECSHICSIDYTVVLGLGELLEDLR
KQGISLAFVGLQVPVLRALLAADLKGFQYFSTLEEAEKYLRQEPGPEPYNICEDCVPEHK
VALLKA
Download sequence
Identical sequences G5AKN5
HGL_H00000355384

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]