SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000355511 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000355511
Domain Number 1 Region: 4-142,179-441
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.17e-71
Family GDI-like N domain 0.000000000358
Further Details:      
 
Domain Number 2 Region: 449-559
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 2.12e-36
Family GDI-like 0.00000401
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000355511
Sequence length 651
Comment CHML (Homo_sapiens) choroideremia-like (Rab escort protein 2)
Sequence
MADNLPTEFDVVIIGTGLPESILAAACSRSGHRVLHVDSRSYYGGNWASFSFSGLLSWLK
EYQQNGDTEEETAAAWQDLIHETEEAIALCKKDETIQHTEVFCYASQNSGDSVHEIGALQ
KNASSVASSTFTEPLPSAELPEERHSYVTNNEMPAKHASESDSKISVEEGDVEESPEKEK
YCGDKTCIHPGSDGDKVENKPIVDDDNNQLKRNVITYHQMVQESRRFNIDLVSKLLYSQG
SLIDLLIKSNVSHYAEFKNVTRILAFREGKVEQVPCSRADVFNSKELTMVEKRVLMKFLT
FCLDYEQHPGEYQDFQQCLFSEFLKTKKLTPNLQHFILHSIAMTSESSCTTLDGLKATKN
FLQCLGRFGNTPFLFPLYGQGEIPQCFCRMCAVFGGIYCLRHTIQCLVVDKESRRCKAVI
DRFGQRINADYFIVEDSYLNKETCSDVQYKQISRAVLITDQSILKADSDQQISILIVPPV
EPGASSVRVIELCSSTMTCMKDTYLVHLTCESSKTAREDLESVVKKLFTPLTETEVDKEE
LRKPSLLWALYFNMRDSSGVSRSSYCGLPCNVYVCSGPDSGLGSEHAVKLAETMFQEIFP
SEEFCPPPPNPEDIIFDGDDKQADAPGTHTTTVANLESPEESKKLESPLQS
Download sequence
Identical sequences G5BL26
XP_004853529.1.39548 HGL_H00000355511

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]