SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000356194 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000356194
Domain Number 1 Region: 72-202
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 8.37e-46
Family Regulator of G-protein signaling, RGS 0.00000189
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000356194
Sequence length 210
Comment RGS17 (Homo_sapiens) regulator of G-protein signaling 17
Sequence
MRKRQQSQNEGTPAVSQAPGNQRPNNTCCFCWCCCCSCSCLTVRNEERGESAGRPIHTTK
MESIQVLEESQSPTADEVLSWSQNFDKMMKAPAGRNLFREFLRTEYSEENLLFWLACEDL
KKEQNKKVIEEKARMIYEDYISILSPKEVSLDSRVREVINRNLLDPNPHMYEDAQLQIYT
LMHRDSFPRFLNSQIYKSFVESTAGSSSES
Download sequence
Identical sequences G5BQ66
HGL_H00000356194

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]