SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000356634 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000356634
Domain Number 1 Region: 246-444
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.03e-31
Family Leech intramolecular trans-sialidase, N-terminal domain 0.09
Further Details:      
 
Domain Number 2 Region: 685-829
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 0.000000000121
Family Matrix metalloproteases, catalytic domain 0.063
Further Details:      
 
Domain Number 3 Region: 1523-1597
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000025
Family Complement control module/SCR domain 0.0024
Further Details:      
 
Domain Number 4 Region: 1469-1529
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000264
Family Complement control module/SCR domain 0.0062
Further Details:      
 
Domain Number 5 Region: 1589-1646
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000528
Family Complement control module/SCR domain 0.0072
Further Details:      
 
Domain Number 6 Region: 843-896,1064-1108
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000812
Family Fibronectin type III 0.0054
Further Details:      
 
Weak hits

Sequence:  HGL_H00000356634
Domain Number - Region: 541-640,720-765
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 0.00012
Family Matrix metalloproteases, catalytic domain 0.081
Further Details:      
 
Domain Number - Region: 1727-1757
Classification Level Classification E-value
Superfamily Notch domain 0.0235
Family Notch domain 0.0063
Further Details:      
 
Domain Number - Region: 1408-1466
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0568
Family Complement control module/SCR domain 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000356634
Sequence length 1790
Comment PAPPA2 (Homo_sapiens) pappalysin 2
Sequence
MMCLKVLRLSLVILAGWLFSTTHSELGWTPKKSFAQKGHLKQVLLEGEHCWLGAKIQRPR
AAPQHHLFGVYPSSTRNYLRPFSVGEQGAHYAGHSKPDTEGKGVSHVSQNLPENTAEVGR
ESEQPAAPWGGDGPIGQSELPGDDDTYLGNQGSKESLGEAAFRESSARATIITTTFAHLK
EPEADTQRKGWAKARLPRQVVMRQAEDVPGDPNISFQPFQHWPKDPLTDRAQSSPLEDSI
QNGGGSPDWEAETFHPQGGLPVLYFSGRRERLLLRPELLADIPREAFTVEAWVRPEGGQN
NPAIIAGVFDNCSHTVNDKGWALGIRSGKDKGRRDARFFFSLRTDRMKKATTMTGHSHYQ
AGTWTHVAATYDGRRMALYVDGTQVASSPGQSGPLNSPFMASCRSLLLGGDSSENGHYFR
GHLGTLAFWSTALSQSHLQHSFQHGSGAEELATLVLTASFDPLKEQWTPFKDEKYPRLEV
LQGSGPKPEILSPLQPPLCGQTVCDNVDLISQYNRHWPLRGEKVIRYQVVNVCDDEGLHP
TVSEEQIQRQHEALNEAFSRYNISWQLSIRRVLNSTLRHRVVLVNCEPSKIGNDHCDPEC
EHPLTGYDGGDCRLQGRCYSWNRRDGICHASCNNMLNDFDDGDCCDPEVADVRKTCFDPD
SPKRAYMSVKELKEALQLNGTHFLNVYFASSVREDLAGAATWPWEKEAVSHLGGVVLNPA
YYGMPGHSNIMIHEVGHVLGLYHVFKGVSERDSCNDPCREMVPSMETGDLCADTAPTPKS
KLCQIPEPANDTCGITHFPGAPFNNYMSYTDDNCTDSFTPNQVARMHCYLDLVYQQWSQS
RKPTPIPIPPVVIGQTRKSLTIHWLPPISGVVYDRAPGSMCGSCSEDGTFRQYVHTASSR
RVCDSSGYWTPEEAVGPPDVDQPCEPSLQAWSPELHLYHMNMTVPCPAEGCSLELLFQYP
VRADTLTLWVTYLSTDSSQALFDTEIMLENQESVHLGPLDTFCDTPLTIKLHVDGKVSGA
KVYTFDERMEIDAALLTSQPRSPLCSGCMPVRYQVVREPPFASGSPMVVTQLHRKFTDME
VTPGQMYQYQVQAEAGAELGEPSPPLHHIHGAPYCGDGKVEKSLGEECDDGDLLDADGCS
RACALEEGFNCVGEPSLCYRYQGDGICEPFEKETSILDCGLHTPKGYLDQWASQAYSSRE
DKKCPVSLVTGEPHSMICTSYHPDLPKYHPFTGWFPCITSGKRPQDEGSEQFEDSLEKEN
EVWLEVCFSRPGVATAVFIFLTSDGLGPGKHQRPTVTLYLTDVSGSNHSLGTHELSCQQN
PLVINVTLHANVLSHCTTSVLLNFSSPLVGISAVALRTSSHISPSAPHNCIAEHERQNHQ
GQSCVHRPCGEQGSCVPLLLDHTDMVNCTSSSPGHMKCAITCQRGFALQTSSGQYLRPIQ
KEILLTCSAGLWDRDVSCMPVDCGIPDPTLVNYANFSCSEGTDFLKRCSISCVPPAKLQG
LSPWLTCLEDGMWSLPEVYCKLECDTPPAIPNANLLLPDCVQGSHDVGTICRYECQPGYH
VLEGTASTVRNKFLKIQCLEGGIWEQGSCVPVVCEPPSPVFEGMYECTNGFNLDSQCVLN
CKQESERLPIVCNKEGLWTREFKLCENLQGECPPPPSELNFLEYKCEQGYGIGAVCFPSC
IIPPNDPVMLPENITADKLEYWMEPVKVQSIVCTGQRQWHPDPLLIHCIQSCEPFQADGW
CDTINNRAYCSYDGGDCCSSTSSSKKVTPFAADCDQDECTCRDPKAEENQ
Download sequence
Identical sequences G5BIA7
XP_004853444.1.39548 HGL_H00000356634

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]