SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000356729 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000356729
Domain Number 1 Region: 2-228
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.66e-54
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0038
Further Details:      
 
Domain Number 2 Region: 310-484
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.0000000000000121
Family FAD/NAD-linked reductases, N-terminal and central domains 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000356729
Sequence length 532
Comment FMO3 (Homo_sapiens) flavin containing monooxygenase 3
Sequence
MVRRVAIIGAGVSGLASIRSCLEEGLEPTCFERSNDIGGLWKFSDHVEEGRASIYKSVFT
NSSKEMMCFPDVPFPDDFPNFMYHGKLQEYIIAFAREKDLLKYIQFETLITSIIKRPDFS
ITGQWDVTTEKDGKKASAVFDAVMICSGHHVYPNIPKESFPGLKDFKGQCFHSRDYKEPG
TWKGKRVLVIGLGNSGCDIAAELSHTAEQVMVSSRSGSWVMSRVWDDGYPWDMVFVTRFQ
TFLKNSLPTAVSDWWYVKQMNARFKHENYGLMPLNGTLRKEPVFNDELPARILCGTVSIK
PNVKKFTETTAIFEDGTMFEKIDCVIFATGYGYAYPFLDESIIRSRNNEVTLFKGIFPPQ
LEKSTLAVIGLVQSLGAAIPTTDLQARYAAQVVKGTCVLPPVKDMMDDIDEKMGKKRKLF
GKSETIQTDYIDYMDELASFIGAKPNILWLFLTDPKLAVEVFFGPCSPYQFRLVGPGKWP
GARNAILTQWDRTLKPTSTRIVGDLLKPSVFFHLFKLLAIPILFIALFLMLI
Download sequence
Identical sequences G5BGT6
HGL_H00000356729 XP_004853513.1.39548 XP_004853514.1.39548 XP_004853515.1.39548 XP_012930789.1.39548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]