SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000357000 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000357000
Domain Number 1 Region: 189-265
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 3.14e-18
Family HLH, helix-loop-helix DNA-binding domain 0.0000376
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000357000
Sequence length 307
Comment USF1 (Homo_sapiens) upstream transcription factor 1
Sequence
QQKTAETEEGTVQIQEGAVATGEDPTSVAIASIQSAATFPDPNVKYVFRTENGGQVMYRV
IQVSEGQLDGQTEGTGAISGYPATQSMTQAVIQGAFTSEDAVDTEGTAAETHYTYFPSTA
VGDGAGGTTSGSTAAVVTTQGSEALLGQSTPPGTGQFFVMMSPQEVLQGGSQRSIAPRTH
PYSPKSEAPRTTRDEKRRAQHNEVERRRRDKINNWIVQLSKIIPDCSMESTKSGQSKGGI
LSKACDYIQELRQSNHRLSEELQGLDQLQLDNDVLRQQVEDLKNKNLLLRAQLRHHGLEV
VIKNDSN
Download sequence
Identical sequences A0A091CKD5 G5BWJ1
HGL_H00000357000

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]