SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000357295 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  HGL_H00000357295
Domain Number - Region: 40-108
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 0.00217
Family Transglutaminase, two C-terminal domains 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000357295
Sequence length 186
Comment SSR2 (Homo_sapiens) signal sequence receptor, beta (translocon-associated protein beta)
Sequence
MYTMRLVAFVTMVLLAVTQAEEGARLLASKSLLNRYAVEGRDLTLQYNIYNVGSSAALDV
ELSDDSFPPEDFGIVSGMLNVKWDRIAPASNVSHTVVLRPLKAGYFNFTSATITYLAQED
GPVVIGSTSAPGQGGILAQREFDRRFSPHFLDWAAFGVMTLPSIGIPLLLWYSSKRKYDT
PKPKKN
Download sequence
Identical sequences G5ARA6
XP_004871229.1.39548 HGL_H00000357295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]