SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000358060 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000358060
Domain Number 1 Region: 307-596
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.65e-82
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.000000237
Further Details:      
 
Domain Number 2 Region: 129-306
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 4.71e-41
Family Threonyl-tRNA synthetase (ThrRS), second 'additional' domain 0.00041
Further Details:      
 
Domain Number 3 Region: 598-704
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 2.27e-25
Family Anticodon-binding domain of Class II aaRS 0.00095
Further Details:      
 
Domain Number 4 Region: 68-129
Classification Level Classification E-value
Superfamily TGS-like 0.000000000085
Family TGS domain 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000358060
Sequence length 715
Comment TARS2 (Homo_sapiens) threonyl-tRNA synthetase 2, mitochondrial (putative)
Sequence
MQLYQRWRPLLLVLRLPGLQAYKLRTLHEASMPTPPHWLVERLGLFEKLWAVQVTRLAST
ARKEARTIKVSLPGGQKVDAVAWNTTPYQLARQMSSTLADTALAAEVNGESYDLERPLET
DSDLRFLTFDSPEGKSVLWHSSAHILGAAAEQFLGAVLCRGPSTDRGFYHDFFLGKERTV
QGSQLPILEQICQRMAADAQPFRRLEVSQDQLRQLFKDNPFKLRVIEEKVTGPTATVYGC
GTLVDLCRGPHLRHAGQIGGLKLLATSSVWRSPGSLEPLQRVLGISFPTPELLRAWEAQR
EEAESRDHRRIGKEQELFFFHELSPGSCFFLPRGTRVYNALVAFIRAEYARRGFSEVKTP
TVFSVKLWKQSGHWGHYRENIFALQPKGSDPARHPTETLALKPMNCPAHCLMFAHRPRSW
RELPVRLADFGALHRAEASGGLGGLTRLWRFQQDDAHIFCAPEQLQAEIRGCLDFLCSVY
AVLGFSFSLSLSTRPSSFLGEPRLWDHAEQVLQQALEESGEPWALKPGDGAFYGPKIDVH
LQDALGRPHQCGTIQLDFQLPMRFNLQYKGQAGALERPVLIHRAVLGSVERLLAVLTESC
GGKWPLWLSPFQVAVIPVGTEQEEYAREIQQSLQAAGLASDLDTDPGLTLSRKVRRAQLT
HYNFQFVVGQKEQSKRTVNIRTRDNRRLGEWDLTAAVQRLLELQNARVSNAEEVF
Download sequence
Identical sequences G5BH39
HGL_H00000358060 XP_004854031.1.39548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]