SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000359206-1 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000359206-1
Domain Number 1 Region: 137-180
Classification Level Classification E-value
Superfamily F-box domain 0.0000000000000144
Family F-box domain 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000359206-1
Sequence length 180
Comment BTRC (Homo_sapiens) beta-transducin repeat containing
Sequence
MDPAEVVLQEKALKYMNSSEREDCNNGEPPRKIIPEKNSLRQTYNSCARLCLNQETVCLA
STAMKTENCVAKTKLANGTSSMIVSKQRKPLASYEKEKELCVKYFEQWSESDQVEFVEHL
ISQMCHYQHGHINSYLKPMLQRDFITALPARGLDHIAENILSYLDATSLCAAELVCKEWY
Download sequence
Identical sequences G5BGG8
HGL_H00000359206-1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]