SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000359206-2 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000359206-2
Domain Number 1 Region: 153-445
Classification Level Classification E-value
Superfamily WD40 repeat-like 5.77e-66
Family WD40-repeat 0.00000000012
Further Details:      
 
Domain Number 2 Region: 38-137
Classification Level Classification E-value
Superfamily F-box domain 4.06e-26
Family F-box domain 0.000001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000359206-2
Sequence length 461
Comment BTRC (Homo_sapiens) beta-transducin repeat containing
Sequence
MATAPSVTTSQLLCGTALLMRNWGRVVEWLPEDTPARGLDHIAENILSYLDATSLCAAEL
VCKEWYRVTSDGMLWKKLIERMVRTDSLWRGLAERRGWGQYLFKNKPPDGSAPPNSFYRA
LYPKIIQDIETIESNWRCGRHSLQRIHCRSETSKGVYCLQYDDQKIVSGLRDNTIKIWDK
STLECKRILTGHTGSVLCLQYDERVIVTGSSDSTVRVWDVNTGEMLNTLIHHCEAVLHLR
FNNGMMVTCSKDRSIAVWDMASPTDITLRRVLVGHRAAVNVVDFDDKYIVSASGDRTIKV
VGHFSVWNTSTCEFVRTLNGHKRGIACLQYRDRLVVSGSSDNTIRLWDIECGACLRVLEG
HEELVRCIRFDNKRIVSGAYDGKIKVWDLLAALDPRAPAGTLCLRTLVEHSGRVFRLQFD
EFQIVSSSHDDTILIWDFLDDPATQAERPHSPSRTYTYISR
Download sequence
Identical sequences G5CAF6
HGL_H00000359206-2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]