SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000360065 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000360065
Domain Number 1 Region: 489-627,662-792
Classification Level Classification E-value
Superfamily WD40 repeat-like 2.38e-35
Family WD40-repeat 0.022
Further Details:      
 
Domain Number 2 Region: 1-119
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 2.67e-26
Family Heat shock protein 90, HSP90, N-terminal domain 0.00000447
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000360065
Sequence length 817
Comment WDR78 (Homo_sapiens) WD repeat domain 78
Sequence
MSLIINTFYSNKETFLRELISNWLYVLDKMSYESLTDASKLDSGKELHINLIPKKQDCTL
TIVDTEIGMIKADLINNLGTITKLGTKAFMEALEAGADISMIGQCGVGSYSAHLVDEKVL
DKNGVDVTPRPLYCPDPHAAKPNKLLSSQEGSLGSDFIASYSMYQNTINPSVMGQFTRSV
LGSSTVSKSSISTTESIAGDLEEPYKGGKLASFTDLRVMRAAPETVLTKEDLEKNVEILL
TETDTLRFFDLPTVMVSVESEDAEKVTQRNKKYEILCKNRLGNDLYVERMMQTFNGAPKN
KDVQCDKIIMEDQGIMATTWDLYDSYSALELSSLAVKRSAIESSSKASVLPRERDQRLLG
STTDKNSEASSLMDIENVILTKVHEDEEDHADAILKSDKFLQDLFFMERVIMENIFQPKL
AAYRQLPVLKEPEPEEPKEFLEGEKVGEVEEEVKKEEEEEIEINAEQSTIPANLERLWSF
SCDLTKGLNVSSLAWNKINPDLLAVGYGHFGFKEQKRGLACCWSIKNPMWPERVYPSPYG
VTAVDFSIGTPNLLAVGYYNGTIMIYNVQSSNNVPVLDSSESPQKHLGPVWQLQWIEQDR
GTTGDDKREFLVSISADGRISKWVIRKGLYCHDLMRLKRTTAGSNVKGGDKEKKGEALLS
RQAPGMCFAFHPKGPVYKVTWNPFCPDIFLSCSADWGVIIWQQENLQPLLSFYPTTHVVY
DITWSPKSSYIFAAANESRVEIWDLHVSILDPLIVNVANPGIKFTTVLFAKHTDCLLVGD
SDGQVAVYELRNMPSASDSGRGDIINTLLGSRSNQPG
Download sequence
Identical sequences G5BSP7
HGL_H00000360065

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]