SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000360216 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000360216
Domain Number 1 Region: 302-508
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 7.48e-67
Family DNA polymerase beta-like 0.0000000195
Further Details:      
 
Domain Number 2 Region: 149-240
Classification Level Classification E-value
Superfamily DNA polymerase beta, N-terminal domain-like 1.44e-26
Family DNA polymerase beta, N-terminal domain-like 0.0000199
Further Details:      
 
Domain Number 3 Region: 242-300
Classification Level Classification E-value
Superfamily PsbU/PolX domain-like 1.55e-17
Family DNA polymerase beta-like, second domain 0.0000474
Further Details:      
 
Domain Number 4 Region: 36-120
Classification Level Classification E-value
Superfamily BRCT domain 0.0000000000196
Family DNA topoisomerase II binding protein 1, TopBP1 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000360216
Sequence length 509
Comment DNTT (Homo_sapiens) deoxynucleotidyltransferase, terminal
Sequence
MDPLQTAHLGPRKKRPRQTGTLMASGPHNIRFGDLVLFILEKKMGTTRRAFLMELARKKG
FRVENELSDSVTHIVAENNSGNDVLEWLQVQNIQASSQLELLDVSWLIECMGAGKPVEMT
GRHQLVVRDSPASPNPGPQKTPSLAVQKIPEYACQRRTTLDNCNYIFTNAFEILAEDCEF
RENEGFYVTYMRAASVLKSLPFTIISMKDTEGIPCLGGRVKCIIEEIIEDGESSEVKAVL
NNERYKSFKLFTSVFGVGLKTSEKWFRMGFRSLSKIRSDKSLTFTRMQKAGFLYYEDLVS
CVTRAEAEAVNMLVKEAVWTFLPGAFISMTGGFRRGKEIGHDVDFLITSPEVTEDEEQQL
LHKVINLWEKKGLLLYSDLVESTFEKLKLPSRKVDALDHFQKCFLILKLHHQRVDNDKSP
QQGGKTWKAIRVDLVMCPYERRAFALLGWTGSRQFERDLRRYATHERKMILDNHALYDKT
KKTFLKAESEEEIFTHLGLDYIEPWERNA
Download sequence
Identical sequences G5BEU5
HGL_H00000360216

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]