SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000360502 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000360502
Domain Number 1 Region: 449-771
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 5.61e-95
Family PDEase 0.00000117
Further Details:      
 
Domain Number 2 Region: 55-226
Classification Level Classification E-value
Superfamily GAF domain-like 2.5e-29
Family GAF domain 0.00039
Further Details:      
 
Domain Number 3 Region: 312-424
Classification Level Classification E-value
Superfamily GAF domain-like 2.9e-24
Family GAF domain 0.00083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000360502
Sequence length 796
Comment PDE6C (Homo_sapiens) phosphodiesterase 6C, cGMP-specific, cone, alpha prime
Sequence
MGEISQDAVEKYLEENPRFAKEYFYKKLHVEALGEIFKNSQTMVMPSMTFPELTQVEESA
LCLELLWSVQEEASSTELVAHKALQRLAQLLQANRCSMFVCRARNGTPEIVSRLLDVTTS
SKFEDNLVVPDREVVFPLDIGIVGWVAHTKKALNVPDVKKNKHFSDFMDKKTGYVTRNLL
ATPIVMGKEVLAVVMAVNKVNASEFSKQDEEVFSKYLNFVSVILRLQHINYLYKVESRRS
QIGLLDMTKEKEFYDEWPIKFGEVEAYKGPKTPDGRVNAKIILDAVSVCYQVLKLRGLGR
TPPADHWTLISGLPTYVAENGFICNMLNAPADEYFTFQKGPVDETGWVIKNVLSLPIVNK
KEDIVGVATFYNRKDGKPFDEHDEHITETLTQFLGWSLLNTDTYEKMNKLENRKDIAQEM
LMNQIKASADEIKSVLKFKEKLNIDVIEDCEEKQLVKILKEDLPDPKAVDLYEFHFSDFP
FTEHELIKCGLQLFFEINVVEKFKVPVEVLTRWMYTVRKGYRSITYHNWRHGFNVGQTMF
TLLMTGRLKKYYTDLEAFAMVAAAFCHDIDHRGTNNLYQMKSTSLLAKLHGTSILERHHL
EYSKTLLKDESLNIFQNLNKQQFDTAIHLFEVAIIATDLALYFKKRTMFQKLVDACEQMQ
TEEEAIKYVTIDPTKKEVIMAMMMTACDPSAISKPWEPMMDRNKKDELPKLQVGFIDFVC
TFVCTEFSRFNKETTPMLNGLQNNRMEWKSLADKYDEKVKIMQEEAKKQEGKINGKTAQD
SGGGGDDKKFKTCLML
Download sequence
Identical sequences G5BE84
HGL_H00000360502

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]