SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000360560 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000360560
Domain Number 1 Region: 178-424
Classification Level Classification E-value
Superfamily RNI-like 1.57e-45
Family 28-residue LRR 0.0072
Further Details:      
 
Domain Number 2 Region: 35-106
Classification Level Classification E-value
Superfamily F-box domain 0.00000148
Family F-box domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000360560
Sequence length 449
Comment TCTE1 (Homo_sapiens) t-complex-associated-testis-expressed 1
Sequence
MAPNFRRMHRIIAEDTEWSLAIVPLLTELCIQNIIRNFQKNPILKQLPPEYQQKVLSHLP
PDLPLAVTANLIDDEGYWHRCCVQRWPVCHVARHGGSWKRLFFERHLEGLLRCFIPGTTD
PSTVLDLLPLCRDFVRNLRVDQLLPPVRLPPTPRKMGDQSDSGSEGEAEESSPDHYPLGP
LVAGLSQLEELDLVYGVKDCGMNFEWNLFLFTYHDCHSLAATVKACHTLKIFRLARSRVD
DDKARILICSLLNHPALEELDLSHNLIGDRGAHGAAKLLSHSRLRVLNLANNRVRAPGAQ
ALAHALAHNAYLLSLNLRLNCIKDEGGQALAHALLTNMCLTTLHLGGNELSEPTAMFLSQ
ALAVNTSLTSINLSCNHIGPDGGKQLLEGVADNKTLLEFDLRLSDVTQESEYLIGQALHA
NREAARQRALNPNHFVLPVIANDPGNSEA
Download sequence
Identical sequences G5BNP2
HGL_H00000360560

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]