SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000361512-2 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000361512-2
Domain Number 1 Region: 2-113
Classification Level Classification E-value
Superfamily PRTase-like 3.12e-27
Family Phosphoribosylpyrophosphate synthetase-like 0.00053
Further Details:      
 
Domain Number 2 Region: 98-151
Classification Level Classification E-value
Superfamily PRTase-like 0.0000111
Family Phosphoribosylpyrophosphate synthetase-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000361512-2
Sequence length 151
Comment PRPS1 (Homo_sapiens) phosphoribosyl pyrophosphate synthetase 1
Sequence
MPNIKIFSSSSHQDLSQKITDHLGLELGKMVTKKFSNQETCVEIGESVRGEDVYIIQSGC
GEINDNLMELLIVINACKIASASRVTAVILCFPYAQQVDNLYAEPAVLKWIRENISEWRN
CTIVLPDAGGAKRVTSIADQLNVDFAVIHKE
Download sequence
Identical sequences G5AM22
HGL_H00000361512-2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]