SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000362777 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000362777
Domain Number 1 Region: 38-100
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 2.62e-20
Family HLH, helix-loop-helix DNA-binding domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000362777
Sequence length 151
Comment ATOH7 (Homo_sapiens) atonal homolog 7 (Drosophila)
Sequence
MKSCKPDRPPGARAAAPCAGGADCAGACAGPGRLESAARRRLAANARERRRMQGLNTAFD
RLRRVVPQWGQDKKLSKYETLQMALSYIMALTRILAEAECFGSERDWVGLHCEHFGRDPY
LPFVGAKLPSESEPCGTRLFSFQPEPFQMPS
Download sequence
Identical sequences G5B7Z2
XP_004847185.1.39548 HGL_H00000362777

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]