SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000363510 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000363510
Domain Number 1 Region: 9-117
Classification Level Classification E-value
Superfamily PWI domain 2.88e-44
Family PWI domain 0.000000887
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000363510
Sequence length 894
Comment SRRM1 (Homo_sapiens) serine/arginine repetitive matrix 1
Sequence
FSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEILGFEDDVVIEFIFNQLE
VKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIPSAFLELKKEEIKQRQI
EQEKLASMKKQDEDKDKRDKEEKESSREKRERSRSPRRRKSRSPSPRRRSSPVRRERKRS
HSRSPRHRTKSRSPSPAPEKKEKTPELPEPSVKVKEPSVQEATSTRQVLKIFPKPEPMPE
PKEPSPEKNSKKEKEKTRPRSRSRSKSRSRTRSRSPSHTRPRRRHRSRSRRRPSPRRRPS
PRRRTPPRRMPPPPRHRRSRSPVRRRRRSSASLSGSSSSSSSSRSRSPPKKPPKRTSSPP
RKTRRLSPSASPPRRRHRPSPPATPPPKTRHSPTPQQSNRTRKSRVSVSPGRTSGKVTKH
KGTEKRESPSPAPKPRKVELSESEEDKGGKMAAADSVQQRRQYRRQNQQSSSDSGSSSSS
EDERPKRSHVKNGEVGRRRRHSPSRSASPSPRKRQKETSPRMQMGKRWQSPVTKSSRRRR
SPSPPPTRRRRSPSPAPPPRRRRSPTPPPRRRTPSPPPRRRSPSPRRYSPPIQRRYSPSP
PPKRRTASPPPPPKRRASPSPPPKRRVSPSPPPKQRSSPVAKRRSPSLSSKHRKGSSPSR
ATRETRSPQPTKRHSPSPRPRAPQTSSPPPVRRGTSASPQRRQSPSPSTRPIRRVSRTPE
PKKTKKAASPSPQSVRRVSSSRSVSGSPEPAAKKPPAPPSPVQSQSPSTNWSPAVPVKKA
KSPTPSPSPARNSDQEGGGKKKKKKKDKKHKKDKKHKKHKKHKKEKAAAAAAGAPITPAA
IAATTTSAQEETEAATEPKKETESEAEDNLDDLEKHLREKALRSMRKAQVSPQS
Download sequence
Identical sequences G5BHW9
HGL_H00000363510

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]